PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1123_f_16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 771aa    MW: 85751.9 Da    PI: 7.6491
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1123_f_16genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.14.8e-15493530239
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      +k+CnCk+skClk+YCeCfaag +C e C+C +C+Nk
  Neem_1123_f_16 493 ACKRCNCKRSKCLKLYCECFAAGLYCVEPCSCLGCFNK 530
                     689**********************************8 PP

2TCR51.32.3e-16578617140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++kkgCnCk+s+ClkkYCeCf+ g+ Cs +C+Ce+CkN+ 
  Neem_1123_f_16 578 RHKKGCNCKRSSCLKKYCECFQGGVGCSISCRCEGCKNSF 617
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.7E-17492533IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.895493618IPR005172CRC domain
PfamPF036384.2E-11495530IPR005172CRC domain
SMARTSM011141.5E-17578619IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.4E-12580616IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MDTPDKNRIA VSSLSKFEDS PVFNYISSLS PIEQIKSINT DNSFNSVTFT SPSSLFATPK  60
INSLRESRFL LSSNQSPDIL KPELHGKENK TSKGNSEAVQ LSEHCTEKLS MERKTRQAKG  120
IQKLFNCLNI ALKNWDFLRQ EVRRERTPVS EGMSCDVKEA SRGQEMAGAS SSLVQSDKGN  180
VADADHFEDK SNLRKICRIE QSQEVEGSDW VSLLSDAVLN SDLSIIENNP EDEDQKTVGT  240
GEISFISTVL QLPQDNANDL TDMVSVSPSC SCKQSDMIEP VTQPEEIRYL KDMDQTPDIL  300
SSNLLNKLVV SDPRAKKDNE EEKCEQSNCK QNNIRRRCLV FEMAGVHKKQ AACETNCRPL  360
IPSKTDCKDA YAEKHLLPSK TKSCSSSMVA GVGLHLNALA TTSKNSKVVK CETLASGRKL  420
ISMRSSLSSS LSLTSCQSLL NKSSTVKSEE RDPVPAGNEV KVMFNQKFFS LWFKVNSLII  480
FRCKPEHNGE SKACKRCNCK RSKCLKLYCE CFAAGLYCVE PCSCLGCFNK PIYEDKVLET  540
RRQIEFRNPL AFAPKVIRGT DSAVEIGDET NKTPASARHK KGCNCKRSSC LKKYCECFQG  600
GVGCSISCRC EGCKNSFGRK DGAEESEYEG EEAEACEKNE LDANISDNVV KEGEEEHPDL  660
LLPSSDIPRA KRSGSSLLLV NPPPKLCISL QTSQFNQPNF EEHFLQSTPE NETTKILKNS  720
FSQSSMIPAS PNSKRVSSPY HEIGSSTRYR SRRFLLRSSL SFPSVTPPRE Q
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471928.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X3
TrEMBLA0A067DFH00.0A0A067DFH0_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17096510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.19e-84Tesmin/TSO1-like CXC domain-containing protein